Antibody Sample

Jump to Filters
View as table Download
Caspase 8 (CASP8) Rabbit Polyclonal Antibody
TA306205

USD 430.00

2 Weeks

Rabbit Polyclonal Caspase-8 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Caspase-8 antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human Caspase-8 isoform A.
Caspase 8 (CASP8) Rabbit Polyclonal Antibody
TA324849

USD 450.00

2 Weeks

Rabbit polyclonal CASP8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8.
Caspase 8 (CASP8) Rabbit Polyclonal Antibody
TA312452

USD 345.00

In Stock

Rabbit polyclonal Caspase 8 (Tyr380) antibody(Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 8 around the phosphorylation site of tyrosine 380 (Q-P-YP-L-E).
Modifications Phospho-specific
Caspase 8 (CASP8) Rabbit Polyclonal Antibody
TA325296

USD 345.00

In Stock

Rabbit Polyclonal Caspase 8 (Ser347) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caspase 8 around the phosphorylation site of Serine 347
Modifications Phospho-specific
Caspase 8 (CASP8) Rabbit Polyclonal Antibody
TA312451

USD 345.00

In Stock

Rabbit polyclonal CASP8 (Cleaved-Asp384) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CASP8.
Caspase 8 (CASP8) Rabbit Polyclonal Antibody
TA325295

USD 345.00

In Stock

Rabbit Polyclonal Caspase 8 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caspase 8
Caspase 8 (CASP8) Mouse Monoclonal Antibody [Clone ID: 90A992]
TA336388

USD 424.00

5 Days

Mouse Monoclonal Caspase-8 Antibody (90A992)

Applications FC, IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
HLAA (HLA-A) Rabbit Polyclonal Antibody
TA343265

USD 375.00

5 Days

Rabbit Polyclonal Anti-HLA-A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ
Caspase 8 (CASP8) Rabbit Polyclonal Antibody
TA306206

USD 430.00

5 Days

Rabbit Polyclonal Caspase-8 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Caspase-8 antibody was raised against a 15 amino acid peptide from near the carboxy terminus human caspase-8 isoform E.
Caspase 8 (CASP8) Mouse Monoclonal Antibody [Clone ID: FLICE 4-1-20]
TA336653

USD 363.00

5 Days

Mouse Monoclonal Caspase-8 Antibody (FLICE 4-1-20)

Applications WB
Reactivities Human
Conjugation Unconjugated
HLAA (HLA-A) Mouse Monoclonal Antibody [Clone ID: OTI4D11]
CF813375

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI4D11

Applications WB
Reactivities Human
Conjugation Unconjugated
HLAA (HLA-A) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF813378

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI2D11

Applications WB
Reactivities Human
Conjugation Unconjugated
HLAA (HLA-A) Mouse Monoclonal Antibody [Clone ID: OTI3H6]
CF813379

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI3H6

Applications WB
Reactivities Human
Conjugation Unconjugated