TPTE (Myc-DDK-tagged)-Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TPTE (Myc-DDK-tagged)-Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TPTE (Myc-DDK-tagged)-Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, TPTE (Myc-DDK tagged) - Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, TPTE (mGFP-tagged) - Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, TPTE (Myc-DDK-tagged)-Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, TPTE (mGFP-tagged)-Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
TPTE (Myc-DDK-tagged)-Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TPTE (GFP-tagged) - Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TPTE (Myc-DDK tagged) - Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TPTE (mGFP-tagged) - Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TPTE (Myc-DDK tagged) - Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TPTE (mGFP-tagged) - Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of TPTE (Myc-DDK-tagged)-Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TPTE (Myc-DDK-tagged)-Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of TPTE (mGFP-tagged)-Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TPTE (mGFP-tagged)-Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TPTE (myc-DDK-tagged) - Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TPTE (GFP-tagged) - Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TPTE (GFP-tagged) - Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TPTE HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of transmembrane phosphatase with tensin homology (TPTE), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti-ORF clone of TPTE (mGFP-tagged)-Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 1
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
TPTE (untagged)-Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Goat Polyclonal Antibody against TPTE
Applications | WB |
Reactivities | Test: Human. Expected from seq similarity: Human |
Immunogen | Peptide with sequence C-ERRTDKTHSEKFQ, from the internal region of the protein sequence according to NP_954870.2; NP_954868.1; NP_954869.1. |
Rabbit polyclonal Anti-TPTE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPTE antibody: synthetic peptide directed towards the middle region of human TPTE. Synthetic peptide located within the following region: YFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFST |
Rabbit Polyclonal Anti-TPTE Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPTE antibody: synthetic peptide directed towards the C terminal of human TPTE. Synthetic peptide located within the following region: KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL |
Rabbit Polyclonal anti-PP2447 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PP2447 antibody: synthetic peptide directed towards the N terminal of human PP2447. Synthetic peptide located within the following region: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK |
Rabbit Polyclonal anti-TRABD antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRABD antibody: synthetic peptide directed towards the middle region of human TRABD. Synthetic peptide located within the following region: LCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTY |
Rabbit Polyclonal Anti-TPTE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPTE antibody: synthetic peptide directed towards the middle region of human TPTE. Synthetic peptide located within the following region: IQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQFFY |
Rabbit Polyclonal Anti-TPTE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPTE antibody: synthetic peptide directed towards the C terminal of human TPTE. Synthetic peptide located within the following region: MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESVLARLSKFEV |
TPTE HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of transmembrane phosphatase with tensin homology (TPTE), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
TPTE MS Standard C13 and N15-labeled recombinant protein (NP_954868)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
TPTE (GFP-tagged) - Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TPTE (untagged)-Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
TPTE (untagged)-Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
TPTE (untagged) - Human transmembrane phosphatase with tensin homology (TPTE), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of TPTE (NM_199259) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TPTE (NM_199260) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack