HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, A (HLA-A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, A (HLA-A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HLA (GFP-tagged) - Human major histocompatibility complex, class I, A (HLA-A)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, HLA (Myc-DDK tagged) - Human major histocompatibility complex, class I, A (HLA-A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, HLA (mGFP-tagged) - Human major histocompatibility complex, class I, A (HLA-A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
HLA (GFP-tagged) - Homo sapiens major histocompatibility complex, class I, A (HLA-A), transcript variant 2 (A*01:01:01:01 allele)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HLA (Myc-DDK tagged) - Homo sapiens major histocompatibility complex, class I, A (HLA-A), transcript variant 2 (A*01:01:01:01 allele)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human major histocompatibility complex, class I, A (HLA-A), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HLA (Myc-DDK tagged) - Human major histocompatibility complex, class I, A (HLA-A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HLA (mGFP-tagged) - Human major histocompatibility complex, class I, A (HLA-A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of major histocompatibility complex, class I, A (HLA-A)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human major histocompatibility complex, class I, A (HLA-A), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
HLA (untagged)-Human major histocompatibility complex, class I, A (HLA-A)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human major histocompatibility complex, class I, A (HLA-A), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
HLA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
HLA (untagged)-Human major histocompatibility complex, class I, A (cDNA clone MGC:17191 IMAGE:4157200), complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-HLA-A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ |
Mouse anti MHC I (HLA-A,B,C) Monoclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI4D11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI2D11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI3H6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
HLA MS Standard C13 and N15-labeled recombinant protein (NP_002107)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
HLA (untagged)-Human major histocompatibility complex, class I, A, mRNA (cDNA clone MGC:2166 IMAGE:3510139), complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
HLA (untagged)-Homo sapiens, clone MGC:2384 IMAGE:2821717, complete cds
Vector | pCMV6 series |
Tag | Tag Free |
HLA (untagged) - Homo sapiens major histocompatibility complex, class I, A (HLA-A), transcript variant 2 (A*01:01:01:01 allele)
Vector | pCMV6 series |
Tag | Tag Free |
HLA mouse monoclonal antibody, clone OTI4D11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
HLA mouse monoclonal antibody, clone OTI4D11, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
2 Weeks
HLA mouse monoclonal antibody, clone OTI4D11, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
HLA mouse monoclonal antibody, clone OTI4D11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
HLA mouse monoclonal antibody, clone OTI2D11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
HLA mouse monoclonal antibody, clone OTI2D11, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
2 Weeks
HLA mouse monoclonal antibody, clone OTI2D11, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
HLA mouse monoclonal antibody, clone OTI2D11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
HLA mouse monoclonal antibody, clone OTI3H6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
HLA mouse monoclonal antibody, clone OTI3H6, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
2 Weeks
HLA mouse monoclonal antibody, clone OTI3H6, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
HLA mouse monoclonal antibody, clone OTI3H6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of HLA-A (NM_002116) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack