Antibody Sample

cDNA Clones (18)
Antibodies (17)
Proteins (8)
Jump to Filters
View as table Download
TGF beta Receptor II (TGFBR2) (NM_003242) Human Tagged ORF Clone Lentiviral Particle
RC219855L1V

USD 1,152.00

3 Weeks

Lenti ORF particles, TGFBR2 (Myc-DDK tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

TGF beta Receptor II (TGFBR2) (NM_003242) Human Tagged ORF Clone Lentiviral Particle
RC219855L2V

USD 1,152.00

3 Weeks

Lenti ORF particles, TGFBR2 (mGFP-tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

TGF beta Receptor II (TGFBR2) (NM_003242) Human Tagged ORF Clone Lentiviral Particle
RC219855L3V

USD 1,152.00

6 Weeks

Lenti ORF particles, TGFBR2 (Myc-DDK tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

TGF beta Receptor II (TGFBR2) (NM_003242) Human Tagged ORF Clone Lentiviral Particle
RC219855L4V

USD 1,152.00

3 Weeks

Lenti ORF particles, TGFBR2 (mGFP-tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

TGF beta Receptor II (TGFBR2) (NM_003242) Human Recombinant Protein
TP319855

USD 867.00

4 Weeks

Recombinant protein of human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
TGF beta Receptor II (TGFBR2) (NM_001024847) Human Tagged ORF Clone
RC223209

USD 550.00

In Stock

TGFBR2 (Myc-DDK-tagged)-Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TGF beta Receptor II (TGFBR2) (NM_001024847) Human Tagged ORF Clone Lentiviral Particle
RC223209L1V

USD 950.00

2 Weeks

Lenti ORF particles, TGFBR2 (Myc-DDK tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

TGF beta Receptor II (TGFBR2) (NM_001024847) Human Tagged ORF Clone Lentiviral Particle
RC223209L2V

USD 950.00

3 Weeks

Lenti ORF particles, TGFBR2 (mGFP-tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

TGF beta Receptor II (TGFBR2) (NM_003242) Human Tagged ORF Clone
RG219855

USD 580.00

In Stock

TGFBR2 (GFP-tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TGF beta Receptor II (TGFBR2) (NM_001024847) Human Tagged ORF Clone
RG223209

USD 600.00

In Stock

TGFBR2 (GFP-tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TGF beta Receptor II (TGFBR2) (NM_001024847) Human Tagged ORF Clone
RC223209L3

USD 750.00

3 Weeks

Lenti ORF clone of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TGF beta Receptor II (TGFBR2) (NM_003242) Human Untagged Clone
SC118072

USD 960.00

In Stock

TGFBR2 (untagged)-Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
TGF beta Receptor II (TGFBR2) (NM_001024847) Human Untagged Clone
SC302306

USD 1,010.00

In Stock

TGFBR2 (untagged)-Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TGF beta Receptor II (TGFBR2) Rabbit Polyclonal Antibody
TA311643

USD 345.00

In Stock

Rabbit polyclonal TGFBR2 (Ab-250) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I).
TGF beta Receptor II (TGFBR2) (NM_003242) Human Tagged ORF Clone
RC219855L4

USD 900.00

In Stock

Lenti ORF clone of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TGF beta Receptor II (TGFBR2) (NM_003242) Human Over-expression Lysate
LY401116

USD 605.00

In Stock

Transient overexpression lysate of transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
TGF beta Receptor II (TGFBR2) Rabbit Polyclonal Antibody
TA324439

USD 450.00

2 Weeks

Rabbit polyclonal TGFBR2 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2.
TGF beta Receptor II (TGFBR2) (NM_003242) Human Over-expression Lysate
LC401116

USD 187.00

In Stock

TGFBR2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
TGF beta Receptor II (TGFBR2) (NM_003242) Human Tagged ORF Clone
RC219855L3

USD 900.00

3 Weeks

Lenti ORF clone of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TGF beta Receptor II (TGFBR2) (NM_001024847) Human Tagged ORF Clone
RC223209L2

USD 750.00

3 Weeks

Lenti ORF clone of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TGF beta Receptor II (TGFBR2) (NM_003242) Human Untagged Clone
SC323450

USD 960.00

In Stock

TGFBR2 (untagged)-Kinase deficient mutant (K277M) of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TGF beta Receptor II (TGFBR2) Rabbit Polyclonal Antibody
TA314620

USD 345.00

In Stock

Rabbit polyclonal TGF beta Receptor II (Ser225/250) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human TGF β Receptor II around the phosphorylation site of serine 225/250 (D-R-SP-D-I).
Modifications Phospho-specific
TGF beta Receptor II (TGFBR2) Rabbit Polyclonal Antibody
AP20273PU-N

USD 370.00

Please Inquire

TGF beta Receptor II (TGFBR2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
TGF beta Receptor II (TGFBR2) Rabbit Polyclonal Antibody
TA314619

USD 345.00

4 Weeks

Rabbit polyclonal TGF beta Receptor II antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β Receptor II antibody.
TGF beta Receptor II (TGFBR2) Rabbit Polyclonal Antibody
TA335780

USD 310.00

5 Days

Rabbit Polyclonal Anti-TGFBR2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-TGFBR2 Antibody: synthetic peptide directed towards the N terminal of human TGFBR2. Synthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT
TGF beta Receptor II (TGFBR2) Rabbit Polyclonal Antibody
TA354580

USD 355.00

5 Days

Rabbit anti TGF beta Receptor II Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal sequence of human TGFbR2
TGF beta Receptor II (TGFBR2) Mouse Monoclonal Antibody [Clone ID: OTI4F3]
CF808048

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TGFBR2 mouse monoclonal antibody, clone OTI4F3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TGF beta Receptor II (TGFBR2) (NM_003242) Human Mass Spec Standard
PH319855

USD 2,055.00

3 Weeks

TGFBR2 MS Standard C13 and N15-labeled recombinant protein (NP_003233)

Tag C-Myc/DDK
Expression Host HEK293
TGF beta Receptor II (TGFBR2) Mouse Monoclonal Antibody [Clone ID: OTI3B4]
TA807912S

USD 159.00

2 Days

TGFBR2 mouse monoclonal antibody,clone OTI3B4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

TGF beta Receptor II (TGFBR2) (NM_003242) Human Recombinant Protein
TP721073

USD 330.00

3 Weeks

Purified recombinant protein of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2

Tag C-Fc
Expression Host HEK293
TGF beta Receptor II (TGFBR2) (NM_003242) Human Recombinant Protein
TP721073L

USD 2,326.00

3 Weeks

Purified recombinant protein of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2

Tag C-Fc
Expression Host HEK293
TGF beta Receptor II (TGFBR2) (NM_003242) Human Recombinant Protein
TP721073M

USD 760.00

3 Weeks

Purified recombinant protein of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2

Tag C-Fc
Expression Host HEK293
TGF beta Receptor II (TGFBR2) (NM_003242) Human Recombinant Protein
TP721073XL

USD 3,660.00

3 Weeks

Purified recombinant protein of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2

Tag C-Fc
Expression Host HEK293