Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Transient overexpression lysate of major histocompatibility complex, class I, A (HLA-A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human major histocompatibility complex, class I, A (HLA-A), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
HLA (untagged)-Human major histocompatibility complex, class I, A (HLA-A)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-HER3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-HER3 whole rabbit serum was prepared by repeated immunizations with a HER3 fusion protein corresponding to amino acids 1283 to 1323 (40 amino acids) at the carboxy-terminus of human HER3. |
TGFBR2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
ERBB3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
HRAS HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human major histocompatibility complex, class I, A (HLA-A), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant s, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
ERBB3 (untagged)-Human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant s
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
TGFBR2 (untagged)-Kinase deficient mutant (K277M) of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal TGF beta Receptor II (Ser225/250) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TGF β Receptor II around the phosphorylation site of serine 225/250 (D-R-SP-D-I). |
| Modifications | Phospho-specific |
Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1, residues 20-643, with C-terminal DDK tag, expressed in sf9, 20ug
| Tag | C-DDK |
| Expression Host | Sf9 |
HLA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
ERBB3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ERBB3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant s
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant s
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
HLA (untagged)-Human major histocompatibility complex, class I, A (cDNA clone MGC:17191 IMAGE:4157200), complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-HLA-A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ |
Recombinant extracellular domain of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1, expressed in human cells
| Tag | C-DDK/His |
| Expression Host | HEK293 |
Purified recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg
| Tag | C-DDK/His |
| Expression Host | HEK293 |
USD 530.00
2 Weeks
ErbB 3 (ERBB3) (C-term) (incl. pos. control) mouse monoclonal antibody, clone 11A4, Biotin
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified
| Applications | IF |
| Reactivities | Human |
| Immunogen | Synhesized non-phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyr1289 (Q-G-YPE-E) |
ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified
| Applications | IF |
| Reactivities | Human |
| Immunogen | Synhesized non-phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyr1289 (Q-G-YPE-E) |
Transient overexpression lysate of v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal TGF beta Receptor II antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β Receptor II antibody. |
Rabbit Polyclonal Anti-TGFBR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TGFBR2 Antibody: synthetic peptide directed towards the N terminal of human TGFBR2. Synthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT |
Rabbit anti c-erbB3 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti c-erbB-3/HER-3 Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti MHC I (HLA-A,B,C) Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti TGF beta Receptor II Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal sequence of human TGFbR2 |
Rabbit anti C-erbB3/HER3 (pY1283) Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti C-erbB3/HER3 (Paired Y1283) Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti C-erbB3/HER3 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
ERBB3 / HER3 (20-643, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
ERBB3 / HER3 (20-643, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
Germany
Japan
United Kingdom
China
