Rabbit Polyclonal Anti-ITGA2 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF |
Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA2 / CD49b antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla, Marmoset, Mouse, Bovine, Elephant, Horse (93%); Rat, Panda, Pig (86%). |
CD49b (ITGA2) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1029~1058 amino acids from the C-terminal region of human CD49b / ITGA2 |
Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA2 / CD49b antibody was raised against synthetic 16 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Panda, Pig (100%); Bovine, Elephant, Horse, Chicken, Lizard (94%); Opossum, Turkey (88%); Bat, Hamster, Stickleback (81%). |
Integrin alpha 2 (ITGA2/CD49b) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human Integrin alpha 2 (ITGA2/CD49b) |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
