Fluorescent Protein Antibodies

Jump to Filters
View as table Download
LTBR Rabbit Polyclonal Antibody
TA314162

USD 345.00

In Stock

Rabbit polyclonal anti-LTBR antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LTBR.
LTBR Rabbit Polyclonal Antibody
TA329151

USD 375.00

5 Days

Rabbit Polyclonal anti-LTBR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LTBR antibody is: synthetic peptide directed towards the N-terminal region of Human LTBR. Synthetic peptide located within the following region: VLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTY