Coronavirus Research Products

Jump to Filters
View as table Download
MASP2 Rabbit Polyclonal Antibody
TA346116

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-MASP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK
Angiotensin Converting Enzyme 2 (ACE2) Rabbit Polyclonal Antibody
AP22661PU-N

USD 525.00

2 Weeks

Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen ACE2 antibody was raised against synthetic peptide
Angiotensin Converting Enzyme 2 (ACE2) (N-term) Rabbit Polyclonal Antibody
AP22858PU-N

USD 440.00

2 Weeks

Angiotensin Converting Enzyme 2 (ACE2) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen ACE2 antibody was raised against synthetic peptide