Coronavirus Research Products

Jump to Filters
View as table Download
ACE2 Rabbit Polyclonal Antibody (Angiotensin Converting Enzyme 2)
TA347899

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ACE2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACE2 Antibody: A synthesized peptide
MASP2 Rabbit Polyclonal Antibody
TA346117

USD 475.00

5 Days

Rabbit Polyclonal Anti-Masp2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Masp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT