Rabbit Monoclonal antibody against WNT5B
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against WNT5B
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-FZD2 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD2. |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LEF1 |
Rabbit Polyclonal Anti-TCF7L2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Anti-FZD4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 37-222 amino acids of human frizzled family receptor 4 |
Rabbit polyclonal antibody to WNT10A (wingless-type MMTV integration site family, member 10A)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 47 and 271 of WNT10A (Uniprot ID#Q9GZT5) |
Rabbit polyclonal anti-FZD5 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD5. |
Rabbit polyclonal anti-FZD3 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD3. |
Rabbit polyclonal anti-FZD10 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD10. |
WNT2B Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
Conjugation | Unconjugated |
Immunogen | WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%). |
Rabbit polyclonal anti-FZD4 antibody
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD4. |
Rabbit polyclonal anti-WNT1 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human WNT1. |
Rabbit polyclonal anti-FZD1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD1. |
Rabbit polyclonal anti-FZD1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD1. |
Rabbit polyclonal anti-FZD8 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD8 |
Rabbit polyclonal anti-FZD9 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human FZD9. |
Rabbit Polyclonal WNT2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal WNT4 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal WNT5B Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Dishevelled 3 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Anti-FZD2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 188-190 amino acids of human led family receptor 2 |
Anti-WNT9A Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 273 amino acids of human wingless-type MMTV integration site family, member 9A |
Anti-FZD4 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 37-222 amino acids of human frizzled family receptor 4 |
Anti-FZD8 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 680-694 amino acids of human frizzled family receptor 8 |
Anti-FZD8 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 680-694 amino acids of human frizzled family receptor 8 |
Anti-FZD3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 133-147 amino acids of human frizzled family receptor 3 |
Anti-FZD3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 133-147 amino acids of human frizzled family receptor 3 |
Anti-FZD10 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 171-185 amino acids of human frizzled family receptor 10 |
Anti-FZD6 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 47-60 amino acids of human frizzled family receptor 6 |
Rabbit Polyclonal Anti-WNT11 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human WNT11 |
Rabbit Polyclonal Anti-WNT3A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human WNT3A |
Rabbit Polyclonal Anti-DVL2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DVL2 |
Rabbit Polyclonal Anti-FZD1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FZD1 |
Rabbit Polyclonal Anti-WNT2B Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT2B |
Rabbit Polyclonal Anti-WNT6 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT6 |
Rabbit Polyclonal Anti-WNT10A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT10A |