Research Areas

View as table Download

Rabbit polyclonal anti-FZD10 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD10.

Rabbit Polyclonal Anti-FZD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the N terminal of human FZD10. Synthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF

Rabbit Polyclonal Frizzled-10 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 150-200 of human Frizzled-10 was used as the immunogen

Anti-FZD10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 171-185 amino acids of human frizzled family receptor 10

FZD10 Antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH

FZD10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 135-230 of human FZD10 (NP_009128.1).
Modifications Unmodified