Frizzled 10 (FZD10) Rabbit Polyclonal Antibody

CAT#: TA356128

FZD10 Antibody

Product Images

Host: Rabbit Target Name: FZD10 Sample Tissue: Human MCF7 Whole Cell Antibody Dilution: 1ug/ml

• 

  TA356128 FZD10 Antibody Sample type: COS7 cells mock transfected Primary Ab dilution: 1:333 Secondary Ab: anti-rabbit-Cy2 Secondary Ab dilution: 1:500 Blue: DAPI Green:FZD10 Data submitted by: Lisa Galli/Laura Burrus San Francisco State University

• 

  TA356128 FZD10 Antibody Sample type: COS7 cells transfected with chick FZD10 Primary Ab dilution: 1:333 Secondary Ab: anti-rabbit-Cy2 Secondary Ab dilution: 1:500 Blue: DAPI Green:FZD10 Data submitted by: Lisa Galli/Laura Burrus San Francisco State University

Specifications

Product Data

• Applications: IF
• Reactivities: Human
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
• Specificity: Expected reactivity: Cow, Dog, Horse, Human, Mouse, Pig
  Homology: Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 100%
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Predicted Protein Size: 65 kDa
• Gene Name: frizzled class receptor 10
• Database Link:
  NP_009128
  Entrez Gene 11211 Human
  UniProt ID Q9ULW2
• Background: This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.
• Synonyms: CD350; FZ-10; FzE7; hFz10

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Basal cell carcinoma, Colorectal cancer, Melanogenesis, Pathways in cancer, Wnt signaling pathway