Research Areas

View as table Download

IL33 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL33

Rabbit Polyclonal Anti-IL33 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC

IL33 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL33