Rabbit Polyclonal Anti-MASP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |
CD46 mouse monoclonal antibody, clone AT2G9, Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
CD46 mouse monoclonal antibody, clone AT2G9, Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
Rabbit polyclonal CD46 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD46 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 317-343 amino acids from the C-terminal region of human CD46. |
Germany
Japan
United Kingdom
China
