Research Areas

Jump to Filters
View as table Download
G0 Protein alpha (GNAO1) Rabbit Polyclonal Antibody
TA333538

USD 375.00

5 Days

Rabbit Polyclonal Anti-GNAO1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the middle region of human GNAO1. Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL
B Raf (BRAF) Mouse Monoclonal Antibody [Clone ID: OTI5A9]
TA500431

USD 379.00

In Stock

BRAF mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
MEK2 (MAP2K2) Mouse Monoclonal Antibody [Clone ID: OTI8G6]
TA500471

USD 379.00

In Stock

Anti-MAP2K2 (MEK2 ) mouse monoclonal antibody, clone OTI8G6 (formerly 8G6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
A RAF (ARAF) Mouse Monoclonal Antibody [Clone ID: OTI2G9]
TA803663

USD 379.00

In Stock

ARAF mouse monoclonal antibody, clone OTI2G9 (formerly 2G9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated