Germany
Japan
United Kingdom
China
USD 390.00
In Stock
MHC Class I Heavy Chain (Restricted expression) mouse monoclonal antibody, clone HC10, Purified
| Applications | ELISA, EM, FC, IF, IHC, IP, WB |
| Reactivities | Human |
Research Areas
DownloadRabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
HLA Class II DR mouse monoclonal antibody, clone L243, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Canine, Human, Primate |
USD 390.00
2 Weeks
MHC Class I Heavy Chain (Restricted expression) mouse monoclonal antibody, clone HCA2, Purified
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Human |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
USD 399.00
In Stock
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
IL3RA mouse monoclonal antibody, clone 6H6, Purified
| Applications | FC, IHC, IP, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
LRP5 + LRP6 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide surrounding amino acid 437 of Human LRP. |
TNFRSF1B mouse monoclonal antibody, clone utr1, Purified
| Applications | FC, IHC, IP, WB |
| Reactivities | Human |
Rabbit polyclonal ROR2 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ROR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-50 amino acids from the N-terminal region of human ROR2. |
WNT3A rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | E.Coli derived recombinant Human WNT-3a |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
CD41 (ITGA2B) (alpha) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide derived from N-terminal domain of CD41 |
Feline Coronavirus mouse monoclonal antibody, clone FIPV3-70, Purified
| Applications | ELISA, FC, IF, IHC, WB |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
NCAM1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NCAM1 |
TA371291 is a possible alternative to TA351057.
Active filters
Applications
- WB
Filter by
Target Symbol
- PECAM1 (109)
- CD4 (107)
- CD99 (79)
- LGALS3 (74)
- PDCD1 (72)
- KIT (71)
- CD68 (65)
- CD19 (64)
- PTPRC (64)
- MAPK8 (63)
- NCAM1 (62)
- MS4A1 (52)
- ESR1 (49)
- WNT3 (47)
- CD34 (44)
- CD5 (42)
- IL1RN (42)
- TNFRSF8 (41)
- IL6 (40)
- CD274 (39)
- CRP (38)
- DVL2 (36)
- MME (34)
- ROR2 (34)
- ANAPC11 (33)
- CD2 (33)
- ANAPC2 (32)
- MAPK9 (31)
- TYRO3 (31)
- FCER2 (30)
- CD22 (29)
- CD79B (29)
- RORA (28)
- IL3RA (26)
- CD33 (24)
- CSF3 (24)
- CD14 (23)
- TNF (21)
- MAPK10 (19)
- PTK7 (18)
- ANPEP (17)
- CD8A (16)
- ROCK2 (16)
- CD3E (15)
- CD74 (15)
- POSTN (15)
- FCGR1A (14)
- IL2 (14)
- LEF1 (13)
- IL36G (12)
- ESR2 (11)
- IL1B (11)
- IL2RA (11)
- ROR1 (11)
- CASP1 (10)
- CEBPD (10)
- IL6R (10)
- IL6ST (10)
- TLR2 (10)
- AGTPBP1 (9)
- CEBPB (9)
- IL1A (9)
- ITGB3 (9)
- WNT3A (9)
- ANAPC5 (8)
- FZD4 (8)
- ROCK1 (8)
- TCF25 (8)
- TLR3 (8)
- TLR4 (8)
- WNT1 (8)
- CALR (7)
- CD79A (7)
- HLA-A (7)
- LRP6 (7)
- TCF4 (7)
- TCF7L2 (7)
- TLR8 (7)
- CD7 (6)
- HLA-DRB5 (6)
- IL36A (6)
- WNT2B (6)
- WNT5B (6)
- CXCL8 (5)
- FZD1 (5)
- FZD2 (5)
- FZD9 (5)
- IL10 (5)
- IL18R1 (5)
- ITGA2B (5)
- TOLLIP (5)
- TSLP (5)
- WNT16 (5)
- ANAPC10 (4)
- ENTPD6 (4)
- FZD10 (4)
- FZD6 (4)
- FZD8 (4)
- HLA-DMB (4)
- HLA-DPB1 (4)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Carrier-free
Knockout (KO) Validation
Modifications
- Unmodified (86)
- Phospho-specific (29)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (3)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (2)
- Phospho S1490 (1)
- Phospho T183/Y185 (1)
- Phospho T183/Y185,Phospho T221/Y223 (1)
- Phospho T235 (1)
- Phospho Y719 (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
Assay Types
Families
- Druggable Genome (2005)
- Transmembrane (1496)
- ES Cell Differentiation/IPS (752)
- Secreted Protein (463)
- Protein Kinase (296)
- Adult stem cells (277)
- Transcription Factors (143)
- Embryonic stem cells (130)
- Induced pluripotent stem cells (111)
- Stem cell - Pluripotency (108)
- Nuclear Hormone Receptor (81)
- Protease (69)
- Phosphatase (64)
- Cancer stem cells (63)
- GPCR (28)
- Stem cell relevant signaling - Wnt Signaling pathway (23)
- Stem cell relevant signaling - JAK/STAT signaling pathway (1)
Pathways
- Hematopoietic cell lineage (740)
- Cell adhesion molecules (CAMs) (651)
- Pathways in cancer (390)
- T cell receptor signaling pathway (338)
- Wnt signaling pathway (306)
- Cytokine-cytokine receptor interaction (283)
- Primary immunodeficiency (260)
- Melanogenesis (243)
- Toll-like receptor signaling pathway (235)
- Leukocyte transendothelial migration (205)
- Colorectal cancer (193)
- Progesterone-mediated oocyte maturation (179)
- Basal cell carcinoma (177)
- MAPK signaling pathway (174)
- NOD-like receptor signaling pathway (170)
- Antigen processing and presentation (153)
- Focal adhesion (135)
- B cell receptor signaling pathway (133)
- RIG-I-like receptor signaling pathway (132)
- Fc epsilon RI signaling pathway (131)
- Jak-STAT signaling pathway (128)
- Adipocytokine signaling pathway (125)
- Type II diabetes mellitus (122)
- ErbB signaling pathway (114)
- Neurotrophin signaling pathway (114)
- Epithelial cell signaling in Helicobacter pylori infection (111)
- GnRH signaling pathway (109)
- Insulin signaling pathway (108)
- Pancreatic cancer (106)
- Prion diseases (103)
- Graft-versus-host disease (94)
- Hedgehog signaling pathway (91)
- Acute myeloid leukemia (87)
- Endocytosis (84)
- Fc gamma R-mediated phagocytosis (84)
- Oocyte meiosis (74)
- Cell cycle (73)
- Ubiquitin mediated proteolysis (73)
- Type I diabetes mellitus (69)
- Apoptosis (64)
- Lysosome (62)
- Allograft rejection (60)
- Regulation of actin cytoskeleton (60)
- Alzheimer's disease (58)
- Hypertrophic cardiomyopathy (HCM) (55)
- Systemic lupus erythematosus (52)
- Renin-angiotensin system (51)
- Pathogenic Escherichia coli infection (48)
- Cytosolic DNA-sensing pathway (47)
- Asthma (38)
- Autoimmune thyroid disease (38)
- Notch signaling pathway (36)
- TGF-beta signaling pathway (36)
- Natural killer cell mediated cytotoxicity (35)
- Amyotrophic lateral sclerosis (ALS) (29)
- Chemokine signaling pathway (29)
- Dilated cardiomyopathy (26)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (22)
- Axon guidance (22)
- Endometrial cancer (22)
- Vascular smooth muscle contraction (22)
- Viral myocarditis (22)
- Metabolic pathways (19)
- Prostate cancer (19)
- Adherens junction (18)
- Glutathione metabolism (17)
- Thyroid cancer (16)
- Renal cell carcinoma (8)
- Bladder cancer (7)
- ECM-receptor interaction (7)
- VEGF signaling pathway (7)
- Chronic myeloid leukemia (6)
- Glioma (6)
- Complement and coagulation cascades (5)
- Non-small cell lung cancer (5)
- Small cell lung cancer (5)
- Long-term depression (4)
- Long-term potentiation (4)
- Melanoma (4)
- mTOR signaling pathway (4)
- Gap junction (3)
- PPAR signaling pathway (3)
- Tight junction (3)
- Purine metabolism (2)
- Pyrimidine metabolism (2)
- Arginine and proline metabolism (1)
- Dorso-ventral axis formation (1)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- Huntington's disease (1)
- Inositol phosphate metabolism (1)
- Parkinson's disease (1)
- Phosphatidylinositol signaling system (1)
- Vibrio cholerae infection (1)