Research Areas

View as table Download

ANAPC15 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANAPC15

Rabbit Polyclonal Anti-ANAPC15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ANAPC15 Antibody is: synthetic peptide directed towards the N-terminal region of Human ANAPC15. Synthetic peptide located within the following region: EETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDED

ANAPC15 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANAPC15