C11orf51 (ANAPC15) Rabbit Polyclonal Antibody

CAT#: TA331984

Rabbit Polyclonal Anti-ANAPC15 Antibody

Product Images

Host: Rabbit; Target Name: ANAPC15; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ANAPC15 Antibody is: synthetic peptide directed towards the N-terminal region of Human ANAPC15. Synthetic peptide located within the following region: EETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDED
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: anaphase promoting complex subunit 15
• Database Link:
  NP_054761
  Entrez Gene 25906 Human
  UniProt ID P60006
• Background: ANAPC15 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. In the complex, it plays a role in the release of the mitotic checkpoint complex (MCC) from the APC/C: not required for APC/C activity itself, but promotes the turnover of CDC20 and MCC on the APC/C, thereby participating to the responsiveness of the spindle assembly checkpoint. It is also required for degradation of CDC20.
• Synonyms: APC15; C11orf51; HSPC020
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 90%; Yeast: 82%