Research Areas

View as table Download

Rabbit Polyclonal Anti-FZD9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF

Rabbit polyclonal anti-FZD9 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human FZD9.

Rabbit Polyclonal Anti-FZD9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: TRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGS

Rabbit polyclonal anti-FZD9 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human FZD9.

Rabbit Polyclonal Anti-FZD9 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Immunogen FZD9 / Frizzled 9 antibody was raised against synthetic 14 amino acid peptide from 1st extracellular domain of human FZD9 / Frizzled 9. Percent identity with other species by BLAST analysis: Human, Gibbon, Mouse, Rat, Hamster, Panda, Dog, Bovine, Bat, Rabbit, Opossum (100%); Platypus (86%).

Rabbit Polyclonal Anti-FZD9 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen FZD9 / Frizzled 9 antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human FZD9 / Frizzled 9. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Mouse, Rat, Bovine (93%).

FZD9 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 469-591 of human FZD9 (NP_003499.1).
Modifications Unmodified