Germany
Japan
United Kingdom
China
FZD9 (Myc-DDK-tagged)-Human frizzled family receptor 9 (FZD9)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Research Areas
View as table Download
USD 880.00
3 Weeks
Lenti ORF particles, FZD9 (Myc-DDK tagged) - Human frizzled family receptor 9 (FZD9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 880.00
6 Weeks
Lenti ORF particles, FZD9 (mGFP-tagged) - Human frizzled family receptor 9 (FZD9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
FZD9 (GFP-tagged) - Human frizzled family receptor 9 (FZD9)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Fzd9 (Myc-DDK-tagged) - Mouse frizzled homolog 9 (Drosophila) (Fzd9)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FZD9 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN405325 is the updated version of KN205325.
Fzd9 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN506211 is the updated version of KN306211.
Fzd9 (GFP-tagged) - Mouse frizzled homolog 9 (Drosophila) (Fzd9), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Fzd9 (Myc-DDK-tagged) - Mouse frizzled homolog 9 (Drosophila) (Fzd9)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fzd9 (Myc-DDK-tagged) - Mouse frizzled homolog 9 (Drosophila) (Fzd9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Fzd9 (mGFP-tagged) - Mouse frizzled homolog 9 (Drosophila) (Fzd9)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fzd9 (GFP-tagged) - Mouse frizzled homolog 9 (Drosophila) (Fzd9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human frizzled family receptor 9 (FZD9), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
7 Weeks
Lenti ORF particles, FZD9 (Myc-DDK tagged) - Human frizzled family receptor 9 (FZD9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 880.00
3 Weeks
Lenti ORF particles, FZD9 (mGFP-tagged) - Human frizzled family receptor 9 (FZD9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Fzd9 (Myc-DDK-tagged ORF) - Rat frizzled homolog 9 (Drosophila) (Fzd9), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Fzd9 (Myc-DDK-tagged ORF) - Rat frizzled homolog 9 (Drosophila) (Fzd9), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fzd9 (Myc-DDK-tagged ORF) - Rat frizzled homolog 9 (Drosophila) (Fzd9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Fzd9 (mGFP-tagged ORF) - Rat frizzled homolog 9 (Drosophila) (Fzd9), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fzd9 (GFP-tagged ORF) - Rat frizzled homolog 9 (Drosophila) (Fzd9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
FZD9 (untagged)-Human frizzled family receptor 9 (FZD9)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Lenti ORF clone of Human frizzled family receptor 9 (FZD9), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
FZD9 (untagged)-Human frizzled homolog 9 (Drosophila) (cDNA clone MGC:26396 IMAGE:4791657), complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: TRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGS |
FZD9 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of frizzled homolog 9 (Drosophila) (FZD9)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human frizzled family receptor 9 (FZD9), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-FZD9 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human FZD9. |
FZD9 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
qSTAR qPCR primer pairs against mus musculus gene Fzd9
Rabbit Polyclonal Anti-FZD9 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | FZD9 / Frizzled 9 antibody was raised against synthetic 14 amino acid peptide from 1st extracellular domain of human FZD9 / Frizzled 9. Percent identity with other species by BLAST analysis: Human, Gibbon, Mouse, Rat, Hamster, Panda, Dog, Bovine, Bat, Rabbit, Opossum (100%); Platypus (86%). |
Rabbit Polyclonal Anti-FZD9 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | FZD9 / Frizzled 9 antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human FZD9 / Frizzled 9. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Mouse, Rat, Bovine (93%). |
FZD9 CRISPRa kit - CRISPR gene activation of human frizzled class receptor 9
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Fzd9 CRISPRa kit - CRISPR gene activation of mouse frizzled class receptor 9
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene FZD9
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene FZD9
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene FZD9
Fzd9 (untagged) - Mouse frizzled homolog 9 (Drosophila) (Fzd9), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Fzd9 (untagged ORF) - Rat frizzled homolog 9 (Drosophila) (Fzd9), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Fzd9 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Fzd9 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
FZD9 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 469-591 of human FZD9 (NP_003499.1). |
| Modifications | Unmodified |
Transient overexpression of FZD9 (NM_003508) in HEK293T cells paraffin embedded controls for ICC/IHC staining
FZD9 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
FZD9 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Fzd9 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Fzd9 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Fzd9 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- FZD9