Rabbit polyclonal anti-CEBPE antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CEBPE. |
Rabbit polyclonal anti-CEBPE antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CEBPE. |
Rabbit Polyclonal CEBPD Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal CEBPD antibody was raised against an 18 amino acid peptide near the carboxy terminus of human CEBPD. |
Rabbit Polyclonal Anti-CEBPD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CEBPD antibody: synthetic peptide directed towards the middle region of human CEBPD. Synthetic peptide located within the following region: RNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAG |
Anti-CEBPD Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 210-225 amino acids of Human CCAAT/enhancer-binding protein delta |
Anti-CEBPD Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 210-225 amino acids of Human CCAAT/enhancer-binding protein delta |