Research Areas

View as table Download

Rabbit polyclonal CEBP Delta antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to the amino terminus of mouse C/EBP.

Rabbit polyclonal anti-CEBPE antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CEBPE.

Rabbit Polyclonal CEBPD Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CEBPD antibody was raised against an 18 amino acid peptide near the carboxy terminus of human CEBPD.

Rabbit polyclonal Rat Cebpd Antibody (Center)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This Rat Cebpd antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 161-189 amino acids from the Central region of rat Cebpd.

Rabbit Polyclonal Anti-CEBPD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPD antibody: synthetic peptide directed towards the middle region of human CEBPD. Synthetic peptide located within the following region: RNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAG

Anti-CEBPD Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 210-225 amino acids of Human CCAAT/enhancer-binding protein delta

Anti-CEBPD Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 210-225 amino acids of Human CCAAT/enhancer-binding protein delta

CEBPD Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CEBPD

CEBPD Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-269 of human CEBPD (NP_005186.2).
Modifications Unmodified

CEBPD Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-269 of human CEBPD (NP_005186.2).
Modifications Unmodified