Germany
Japan
United Kingdom
China
RAF1 (Myc-DDK-tagged)-Human v-raf-1 murine leukemia viral oncogene homolog 1 (RAF1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Research Areas
View as table Download
SRC (Myc-DDK-tagged)-Human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human v-raf-1 murine leukemia viral oncogene homolog 1 (RAF1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
MAP2K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase 1 (MAP2K1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
CDC42 (Myc-DDK-tagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
RAC1 (Myc-DDK-tagged)-Human ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) (RAC1), transcript variant Rac1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
NFATC3 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 (NFATC3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
PTK2 (Myc-DDK-tagged)-Human PTK2 protein tyrosine kinase 2 (PTK2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 880.00
In Stock
PIK3CG (Myc-DDK-tagged)-Human phosphoinositide-3-kinase, catalytic, gamma polypeptide (PIK3CG)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 823.00
In Stock
Recombinant protein of human phosphoinositide-3-kinase, catalytic, gamma polypeptide (PIK3CG)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 (NFATC3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Anti-NFATC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI |
USD 379.00
In Stock
SRC mouse monoclonal antibody,clone OTI6B2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Families
- Druggable Genome
Pathways
- VEGF signaling pathway