Research Areas

Jump to Filters
View as table Download
Granzyme H (GZMH) Rabbit Polyclonal Antibody
TA329501

USD 310.00

5 Days

Rabbit Polyclonal anti-GZMH antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GZMH antibody: synthetic peptide directed towards the N terminal of human GZMH. Synthetic peptide located within the following region: MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG