Granzyme H (GZMH) Rabbit Polyclonal Antibody

CAT#: TA329501

Rabbit Polyclonal anti-GZMH antibody

Product Images

WB Suggested Anti-GZMH Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GZMH antibody: synthetic peptide directed towards the N terminal of human GZMH. Synthetic peptide located within the following region: MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: granzyme H
• Database Link:
  NP_219491
  Entrez Gene 2999 Human
  UniProt ID P20718
• Background: This enzyme is probably necessary for target cell lysis in cell-mediated immune responses.
• Synonyms: CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2
• Note: Immunogen sequence homology: Human: 100%; Rat: 92%; Mouse: 91%; Horse: 85%

Reference Data

• Protein Families: Druggable Genome, Protease