Research Areas

cDNA Clones (21)
Proteins (10)
Antibodies (2)
Jump to Filters
View as table Download
IL36RN (NM_173170) Human Tagged ORF Clone
RC205747

USD 98.00

USD 390.00

In Stock

IL36RN (Myc-DDK-tagged)-Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
IL36RN (NM_012275) Human Tagged ORF Clone
RC211691

USD 98.00

USD 390.00

In Stock

IL36RN (Myc-DDK-tagged)-Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
IL36RN (NM_173170) Human Tagged ORF Clone Lentiviral Particle
RC205747L1V

USD 820.00

3 Weeks

Lenti ORF particles, IL36RN (Myc-DDK tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
IL36RN (NM_173170) Human Tagged ORF Clone Lentiviral Particle
RC205747L2V

USD 820.00

6 Weeks

Lenti ORF particles, IL36RN (mGFP-tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
IL36RN (NM_012275) Human Tagged ORF Clone Lentiviral Particle
RC211691L1V

USD 820.00

4 Weeks

Lenti ORF particles, IL36RN (Myc-DDK tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
IL36RN (NM_012275) Human Tagged ORF Clone Lentiviral Particle
RC211691L2V

USD 820.00

6 Weeks

Lenti ORF particles, IL36RN (mGFP-tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
IL36RN (NM_173170) Human Tagged ORF Clone
RG205747

USD 460.00

In Stock

IL36RN (GFP-tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IL36RN (NM_012275) Human Tagged ORF Clone
RG211691

USD 460.00

In Stock

IL36RN (GFP-tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IL36RN (NM_173170) Human Tagged ORF Clone
RC205747L3

USD 620.00

3 Weeks

Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IL36RN (NM_173170) Human Tagged ORF Clone Lentiviral Particle
RC205747L3V

USD 820.00

5 Weeks

Lenti ORF particles, IL36RN (Myc-DDK tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IL36RN (NM_173170) Human Tagged ORF Clone
RC205747L4

USD 620.00

3 Weeks

Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IL36RN (NM_173170) Human Tagged ORF Clone Lentiviral Particle
RC205747L4V

USD 820.00

7 Weeks

Lenti ORF particles, IL36RN (mGFP-tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IL36RN (NM_012275) Human Tagged ORF Clone
RC211691L3

USD 620.00

3 Weeks

Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IL36RN (NM_012275) Human Tagged ORF Clone Lentiviral Particle
RC211691L3V

USD 820.00

6 Weeks

Lenti ORF particles, IL36RN (Myc-DDK tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IL36RN (NM_012275) Human Tagged ORF Clone
RC211691L4

USD 620.00

3 Weeks

Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IL36RN (NM_012275) Human Tagged ORF Clone Lentiviral Particle
RC211691L4V

USD 820.00

6 Weeks

Lenti ORF particles, IL36RN (mGFP-tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IL36RN (NM_012275) Human Untagged Clone
SC115434

USD 310.00

In Stock

IL36RN (untagged)-Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
IL36RN (NM_173170) Human Tagged ORF Clone
RC205747L2

USD 620.00

3 Weeks

Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
IL36RN (NM_012275) Human Tagged ORF Clone
RC211691L1

USD 620.00

In Stock

Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
IL36RN (NM_012275) Human Tagged ORF Clone
RC211691L2

USD 620.00

3 Weeks

Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
IL36RN Rabbit Polyclonal Antibody
TA326668

USD 430.00

5 Days

Rabbit Polyclonal IL-36RN Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IL-36RN antibody was raised against a 19 amino acid peptide near the carboxy terminus of human IL-36RN.
IL36RN (NM_173170) Human Over-expression Lysate
LY406658

USD 396.00

5 Days

Transient overexpression lysate of interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
IL36RN (NM_173170) Human Untagged Clone
SC322542

USD 420.00

In Stock

IL36RN (untagged)-Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
IL36RN Rabbit Polyclonal Antibody
TA330956

USD 375.00

5 Days

Rabbit polyclonal Anti-IL1F5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL1F5 antibody: synthetic peptide directed towards the middle region of human IL1F5. Synthetic peptide located within the following region: LTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
IL1F5 / IL1L1 (1-155, His-tag) Human Protein
AR51639PU-N

USD 845.00

2 Weeks

IL1F5 / IL1L1 (1-155, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
IL1F5 / IL1L1 (1-155, His-tag) Human Protein
AR51639PU-S

USD 330.00

2 Weeks

IL1F5 / IL1L1 (1-155, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
IL36RN (NM_012275) Human Over-expression Lysate
LC402185

USD 121.00

2 Weeks

IL36RN HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
IL36RN (NM_173170) Human Over-expression Lysate
LC406658

USD 121.00

2 Weeks

IL36RN HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
IL36RN (NM_012275) Human Over-expression Lysate
LY402185

USD 396.00

5 Days

Transient overexpression lysate of interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
IL36RN (NM_173170) Human Mass Spec Standard
PH305747

USD 2,055.00

3 Weeks

IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_775262)

Tag C-Myc/DDK
Expression Host HEK293
IL36RN (NM_012275) Human Mass Spec Standard
PH311691

USD 2,055.00

3 Weeks

IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_036407)

Tag C-Myc/DDK
Expression Host HEK293
IL36RN Cytosection
TS405747P5

USD 889.00

4 Weeks

Transient overexpression of IL36RN (NM_173170) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

IL36RN Cytosection
TS411691P5

USD 889.00

4 Weeks

Transient overexpression of IL36RN (NM_012275) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack