WNT1 (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 1 (WNT1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WNT1 (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 1 (WNT1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WNT1 (untagged)-Human wingless-type MMTV integration site family, member 1 (WNT1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
WNT1 (GFP-tagged) - Human wingless-type MMTV integration site family, member 1 (WNT1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, WNT1 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 1 (WNT1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, WNT1 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 1 (WNT1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 1 (WNT1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT1 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 1 (WNT1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 1 (WNT1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT1 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 1 (WNT1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human wingless-type MMTV integration site family, member 1 (WNT1).
Tag | Tag Free |
Expression Host | E. coli |
Transient overexpression lysate of wingless-type MMTV integration site family, member 1 (WNT1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
WNT1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 1 (WNT1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-WNT1 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human WNT1. |
WNT1 (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human WNT1 |
Rabbit polyclonal anti-Wnt-1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E. coli expressed human Wnt-1 |
Rabbit polyclonal anti-Wnt1 antibody
Applications | WB |
Reactivities | Bovine, Human, Macaque, Mouse, Opossum, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Wnt1 protein. |
Mouse monoclonal anti-Wnt1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-Human WNT-1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human WNT-1 |
Rabbit Polyclonal Anti-WNT1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT1 antibody: synthetic peptide directed towards the middle region of human WNT1. Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV |
Rabbit Polyclonal Anti-WNT1 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | WNT1 antibody was raised against synthetic 19 amino acid peptide from internal region of human WNT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Elephant, Panda, Bovine, Horse, Rabbit, Pig (100%); Marmoset, Hamster, Chicken, Lizard (95%); Stickleback (84%). |
Rabbit Polyclonal Anti-WNT1 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | WNT1 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Chicken (94%); Lizard (88%); Zebrafish (81%). |
Rabbit Polyclonal Anti-WNT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT1 |
Transient overexpression of WNT1 (NM_005430) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human wingless-type MMTV integration site family, member 1 (WNT1), full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug
Tag | N-GST and C-HIS |
Expression Host | E. coli |
Transient overexpression of WNT1 (NM_005430) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WNT1 (NM_005430) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack