Research Areas

Antibodies (2)
Proteins (2)
cDNA Clones (2)
Jump to Filters
View as table Download
c-Jun (JUN) (NM_002228) Human Tagged ORF Clone
RC209804

USD 420.00

In Stock

JUN (Myc-DDK-tagged)-Human jun proto-oncogene (JUN)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NFAT4 (NFATC3) (NM_173165) Human Tagged ORF Clone
RC200357

USD 98.00

USD 800.00

In Stock

NFATC3 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 (NFATC3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NFAT4 (NFATC3) (NM_173165) Human Recombinant Protein
TP300357

USD 867.00

4 Weeks

Recombinant protein of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 (NFATC3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

c-Jun (JUN) Rabbit Polyclonal Antibody
TA324768

USD 450.00

5 Days

Rabbit polyclonal Phospho-cJun(S63) Antibody

Applications Dot, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun.
Modifications Phospho-specific
AP-1 / c-Jun (1-241, His-tag) Human Protein
AR09900PU-N

USD 845.00

2 Weeks

AP-1 / c-Jun (1-241, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
NFAT4 (NFATC3) Rabbit Polyclonal Antibody
TA330164

USD 375.00

5 Days

Rabbit Polyclonal Anti-NFATC3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI