Germany
Japan
United Kingdom
China
JUN (Myc-DDK-tagged)-Human jun proto-oncogene (JUN)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Research Areas
View as table Download
RAF1 (Myc-DDK-tagged)-Human v-raf-1 murine leukemia viral oncogene homolog 1 (RAF1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
GRB2 (Myc-DDK-tagged)-Human growth factor receptor-bound protein 2 (GRB2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human v-raf-1 murine leukemia viral oncogene homolog 1 (RAF1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
MAP2K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase 1 (MAP2K1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
RAC1 (Myc-DDK-tagged)-Human ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) (RAC1), transcript variant Rac1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
NFATC3 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 (NFATC3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
GSK3B (Myc-DDK-tagged)-Human glycogen synthase kinase 3 beta (GSK3B), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 880.00
In Stock
PIK3CG (Myc-DDK-tagged)-Human phosphoinositide-3-kinase, catalytic, gamma polypeptide (PIK3CG)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 823.00
In Stock
Recombinant protein of human phosphoinositide-3-kinase, catalytic, gamma polypeptide (PIK3CG)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human growth factor receptor-bound protein 2 (GRB2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 399.00
In Stock
Recombinant protein of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 (NFATC3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
CD21 (CR2) mouse monoclonal antibody, clone BB6-11C9.6, Purified
| Applications | FC, IHC, IP |
| Reactivities | Porcine |
CD19 mouse monoclonal antibody, clone HD37, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit polyclonal Phospho-cJun(S63) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun. |
| Modifications | Phospho-specific |
Rabbit Polyclonal CD19 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD19 |
Rabbit Polyclonal CD19 (Tyr531) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD19 around the phosphorylation site of Tyrosine 531 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
CD22 mouse monoclonal antibody, clone B-ly8, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
AP-1 / c-Jun (1-241, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
Rabbit Polyclonal Antibody against CD19 (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-421 amino acids from the C-terminal region of human CD19. |
Rabbit polyclonal CD19 (Ab-531) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CD19 around the phosphorylation site of tyrosine 531 (D-S-YP-E-N). |
CD19 mouse monoclonal antibody, clone 4G7, Purified
| Applications | FC, IF |
| Reactivities | Human |
CD19 mouse monoclonal antibody, clone 4G7, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD19 mouse monoclonal antibody, clone AE1, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD21 (CR2) mouse monoclonal antibody, clone B-E5, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD21 (CR2) mouse monoclonal antibody, clone B-ly4, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-NFATC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI |
CD19 mouse monoclonal antibody, clone 4G7, APC
| Applications | FC |
| Reactivities | Human |
| Conjugation | APC |
CD19 mouse monoclonal antibody, clone 4G7, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD19 mouse monoclonal antibody, clone B-C3, Azide Free
| Applications | FC |
| Reactivities | Human |
CD19 mouse monoclonal antibody, clone B-C3, Biotin
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
CD19 mouse monoclonal antibody, clone B-C3, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD19 mouse monoclonal antibody, clone B-C3, Purified
| Applications | FC |
| Reactivities | Human |
CD19 mouse monoclonal antibody, clone B-D3, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD19 mouse monoclonal antibody, clone HD37, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD19 mouse monoclonal antibody, clone HD37, PerCP
| Applications | FC |
| Reactivities | Human |
| Conjugation | PerCP |
CD19 mouse monoclonal antibody, clone HD37, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
Mouse Monoclonal CD79a Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD19 Capture mouse monoclonal antibody, Luminex validated, clone OTI2F6
| Applications | LMNX |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700286 |
Active filters
Pathways
- B cell receptor signaling pathway