Research Areas

Jump to Filters
View as table Download
HLAG (HLA-G) Rabbit Polyclonal Antibody
TA325084

USD 450.00

2 Weeks

Rabbit polyclonal HLA-G Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA313322

USD 345.00

In Stock

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.
HLA DMB (HLA-DMB) Rabbit Polyclonal Antibody
TA308239

USD 415.00

5 Days

Rabbit polyclonal antibody to HLA-DMB (major histocompatibility complex, class II, DM beta)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 199 and 263 of HLA-DMB (Uniprot ID#P28068)
HLAB (HLA-B) Rabbit Polyclonal Antibody
TA325053

USD 450.00

5 Days

Rabbit polyclonal HLA-B Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B.
HLAF (HLA-F) Rabbit Polyclonal Antibody
TA331071

USD 375.00

5 Days

Rabbit polyclonal Anti-HLA-F Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT
IL12B Goat Polyclonal Antibody
TA302515

USD 375.00

5 Days

Goat Polyclonal Antibody against IL12B / IL12p40

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QGKSKREKKDRVFTD, from the internal region of the protein sequence according to NP_002178.2.
HLA DM (HLA-DMA) Rabbit Polyclonal Antibody
TA308310

USD 415.00

5 Days

Rabbit polyclonal antibody to HLA-DMA (major histocompatibility complex, class II, DM alpha)

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 52 and 245 of HLA-DMA
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA319289

USD 1,380.00

5 Days

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA319290

USD 1,380.00

5 Days

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA323618

USD 345.00

In Stock

Anti-TNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor