WNT6 (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 6 (WNT6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WNT6 (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 6 (WNT6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, WNT6 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 6 (WNT6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, WNT6 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 6 (WNT6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
WNT6 (GFP-tagged) - Human wingless-type MMTV integration site family, member 6 (WNT6)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 6 (WNT6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT6 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 6 (WNT6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 6 (WNT6), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT6 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 6 (WNT6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
WNT6 (untagged)-Human wingless-type MMTV integration site family, member 6 (WNT6)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of wingless-type MMTV integration site family, member 6 (WNT6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal anti-Wnt-6 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 276 of mouse Wnt-6 |
WNT6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 6 (WNT6), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Purified recombinant protein of Human wingless-type MMTV integration site family, member 6 (WNT6),Pro32-Phe82, with N-terminal His-ABP tag, expressed in E. coli, 50ug
Tag | N-His-ABP |
Expression Host | E. coli |
WNT6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 172-201 amino acids from the Central region of human WNT6 |
WNT6 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Rabbit |
Conjugation | Unconjugated |
Immunogen | WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%). |
WNT6 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Mouse, Rabbit, Rat |
Immunogen | WNT6 antibody was raised against synthetic 20 amino acid peptide from N-terminus of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit (100%); Marmoset, Bat, Opossum, Platypus (95%). |
Rabbit Polyclonal Anti-WNT6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT6 antibody: synthetic peptide directed towards the middle region of human WNT6. Synthetic peptide located within the following region: ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG |
Rabbit Polyclonal Anti-WNT6 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT6 |
Transient overexpression of WNT6 (NM_006522) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human wingless-type MMTV integration site family, member 6 (WNT6), full length, with N-GST and C-His tag, expressed in E.coli, 50ug
Tag | N-GST and C-HIS |
Expression Host | E. coli |
Transient overexpression of WNT6 (NM_006522) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WNT6 (NM_006522) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack