Research Areas

View as table Download

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (GFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (GFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (GFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit polyclonal Anti-HLA-F Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT

HLA (untagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

HLA (untagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3

Vector pCMV6 series
Tag Tag Free

HLA (untagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of HLA (NM_001098479) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack