Research Areas

Antibodies (1)
Proteins (1)
cDNA Clones (1)
Jump to Filters
View as table Download
NFAT4 (NFATC3) (NM_173165) Human Tagged ORF Clone
RC200357

USD 98.00

USD 800.00

In Stock

NFATC3 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 (NFATC3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NFAT4 (NFATC3) (NM_173165) Human Recombinant Protein
TP300357

USD 867.00

4 Weeks

Recombinant protein of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 (NFATC3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

NFAT4 (NFATC3) Rabbit Polyclonal Antibody
TA330164

USD 375.00

5 Days

Rabbit Polyclonal Anti-NFATC3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI