Products

Jump to Filters
View as table Download
MFI2 (MELTF) Rabbit Polyclonal Antibody
TA342916

USD 375.00

5 Days

Rabbit Polyclonal Anti-MFI2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MFI2 antibody: synthetic peptide directed towards the C terminal of human MFI2. Synthetic peptide located within the following region: CVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENA