Products

Jump to Filters
View as table Download
HIPK1 (C-term) Rabbit Polyclonal Antibody
AP52049PU-N

USD 450.00

2 Weeks

HIPK1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 892-922 amino acids from the C-terminal region of human HIPK1
HIPK1 Rabbit Polyclonal Antibody
TA342143

USD 375.00

5 Days

Rabbit polyclonal Anti-HIPK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HIPK1 antibody: synthetic peptide directed towards the middle region of human HIPK1. Synthetic peptide located within the following region: PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS