Products

View as table Download

RNASE1 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Ribonuclease A isolated and purified from bovine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure.

RNASE1 rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Conjugation Biotin
Immunogen Ribonuclease A isolated and purified from bovine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure.

RNASE1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Ribonuclease A isolated and purified from bovine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal Anti-RNASE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNASE1 antibody: synthetic peptide directed towards the middle region of human RNASE1. Synthetic peptide located within the following region: MHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST

Rabbit Polyclonal Anti-RNASE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNASE1 antibody: synthetic peptide directed towards the N terminal of human RNASE1. Synthetic peptide located within the following region: MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSS

RNASE1 rabbit polyclonal antibody, Serum

Applications ELISA, IP, WB
Reactivities Bovine
Immunogen Ribonuclease A [Bovine Pancreas].

RNASE1 rabbit polyclonal antibody, Biotin, Purified

Applications ELISA, IP, WB
Reactivities Bovine
Conjugation Biotin
Immunogen Ribonuclease A from bovine pancreas

RNASE1 rabbit polyclonal antibody, HRP, Purified

Applications ELISA, IP, WB
Reactivities Bovine
Conjugation HRP
Immunogen Ribonuclease A from bovine pancreas

RNASE1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RNASE1

RNASE1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RNASE1

RNASE1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-156 of human RNASE1 (NP_937875.1).
Modifications Unmodified