Rabbit Polyclonal Anti-PARN Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARN antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLKKHSMDFLLFQ |
PARN Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PARN (NP_002573.1). |
| Modifications | Unmodified |
PARN Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PARN (NP_002573.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
