Parn Rabbit Polyclonal Antibody

CAT#: TA329951

Rabbit Polyclonal Anti-PARN Antibody

Product Images

WB Suggested Anti-PARN Antibody Titration: 1.25ug/ml; ELISA Titer: 1:312500; Positive Control: SP2/0 cell lysate

• 

  Lanes: Lane 1: 7 ug HEK293 cytoplasmic lysate; 2: 7ug HEK293 nuclei lysate; Primary Antibody Dilution:1:500; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution:1:500; Gene Name:PARN; Submitted by:Seiji Masuda, Kitashirakawa Oiwakecho, Kyoto

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PARN antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLKKHSMDFLLFQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: poly(A)-specific ribonuclease (deadenylation nuclease)
• Database Link:
  NP_083037
  Entrez Gene 5073 HumanEntrez Gene 74108 Mouse
  UniProt ID Q8VDG3
• Background: PARN is an oligomeric, processive, and cap-interacting 3' exonuclease.
• Synonyms: DAN
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 83%