HCN1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human HCN1 |
HCN1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human HCN1 |
Rabbit Polyclonal Anti-HCN2
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)EEAGPAGEPRGSQAS, corresponding to amino acid residues 147-161 of human HCN2. Intracellular, N-terminus. |
Rabbit Polyclonal antibody to CNGA2 (cyclic nucleotide gated channel alpha 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 412 and 664 of CNGA2 (Uniprot ID#Q16280) |
Rabbit polyclonal anti-CNGA2 antibody
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CNGA2. |
Rabbit polyclonal Anti-HCN4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GST fusion protein with sequence HGHLHDSAEERRLIAEGDASPG EDRTPPGLAAEPERP, corresponding to amino acid residues 119-155 of human HCN4 , (MW: 31 kDa.).? ? Intracellular, N-terminus. |
CNGA4 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 138-168 amino acids from the N-terminal region of human CNGA4 |
CNGB3 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 33-63 amino acids from the N-terminal region of human CNGB3 |
Rabbit polyclonal anti-CNGA1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CNGA1. |
Rabbit Polyclonal Anti-CNGA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CNGA4 Antibody is: synthetic peptide directed towards the N-terminal region of Human CNGA4. Synthetic peptide located within the following region: RIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQ |
Rabbit Polyclonal Anti-HCN3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HCN3 antibody: synthetic peptide directed towards the middle region of human HCN3. Synthetic peptide located within the following region: LQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPV |
Anti-CNGA1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 45-58 amino acids of Human cyclic nucleotide gated channel alpha 1 |
Anti-CNGA1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 45-58 amino acids of Human Cyclic nucleotide gated channel alpha 1 |
Anti-CNGA2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 475-662 amino acids of human cyclic nucleotide gated channel alpha 2 |
Anti-CNGA2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 475-662 amino acids of human cyclic nucleotide gated channel alpha 2 |
Anti-HCN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 874-886 amino acids of Human hyperpolarization activated cyclic nucleotide-gated potassium channel 1 |
Anti-HCN2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 874-886 amino acids of Human hyperpolarization activated cyclic nucleotide-gated potassium channel 2 |
Anti-CNGA3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 482-605 amino acids of human cyclic nucleotide gated channel alpha 3 |
Rabbit Polyclonal Anti-HCN4 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HCN4 |