Products

Jump to Filters
View as table Download
PGCP (CPQ) Rabbit Polyclonal Antibody
TA346623

USD 475.00

5 Days

Rabbit Polyclonal Anti-PGCP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGCP antibody: synthetic peptide directed towards the N terminal of human PGCP. Synthetic peptide located within the following region: VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA
PGCP (CPQ) Rabbit Polyclonal Antibody
TA307994

USD 415.00

5 Days

Rabbit polyclonal antibody to PGCP

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 19 and 296 of PGCP (Uniprot ID#Q9Y646)