Products

Jump to Filters
View as table Download
TJAP1 Rabbit Polyclonal Antibody
TA356262

USD 360.00

5 Days

TJAP1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TJAP1
TJP2 Rabbit Polyclonal Antibody
TA356264

USD 360.00

5 Days

TJP2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TJP2
TJP2 Rabbit Polyclonal Antibody
TA356265

USD 360.00

5 Days

TJP2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TJP2
Cortactin (CTTN) Rabbit Polyclonal Antibody
TA357008

USD 360.00

5 Days

CTTN Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CTTN
Cortactin (CTTN) Rabbit Polyclonal Antibody
TA357010

USD 360.00

5 Days

CTTN Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human CTTN
PPP2R1A Rabbit Polyclonal Antibody
TA357329

USD 360.00

5 Days

PPP2R1A Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R1A
GNAI3 Rabbit Polyclonal Antibody
TA357480

USD 360.00

5 Days

GNAI3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GNAI3
GNAI3 Rabbit Polyclonal Antibody
TA357481

USD 360.00

5 Days

GNAI3 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GNAI3
Junctional Adhesion Molecule 1 (F11R) Rabbit Polyclonal Antibody
TA357847

USD 360.00

5 Days

F11R Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Junctional Adhesion Molecule 1 (F11R) Rabbit Polyclonal Antibody
TA357848

USD 360.00

5 Days

F11R Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
AIP1 (MAGI2) Rabbit Polyclonal Antibody
TA357861

USD 360.00

5 Days

MAGI2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody
TA358331

USD 360.00

5 Days

PPP2CA Antibody - N-terminal region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
NRAS Rabbit Polyclonal Antibody
TA358396

USD 360.00

5 Days

NRAS Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
YES1 Rabbit Polyclonal Antibody
TA358529

USD 360.00

5 Days

YES1 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTA
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA890010

USD 295.00

In Stock

Rabbit polyclonal anti-ACTB(beta Actin) antibody, Loading control

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen ACTB Synthetic peptide conjugated to KLH derived from within residues 30-100 of Human ACTB
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA890010S

USD 159.00

2 Days

Rabbit polyclonal anti-ACTB(beta Actin) antibody, Loading control

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen ACTB Synthetic peptide conjugated to KLH derived from within residues 30-100 of Human ACTB
PKC delta (PRKCD) Rabbit Polyclonal Antibody
TA890030

USD 345.00

In Stock

Rabbit polyclonal anti-PRKCD Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKCD
PKC delta (PRKCD) Rabbit Polyclonal Antibody (Biotin conjugated)
TA890030AM

USD 420.00

4 Weeks

Rabbit polyclonal anti-PRKCD Antibody, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Immunogen Recombinant protein of human PRKCD
PKC delta (PRKCD) Rabbit Polyclonal Antibody (HRP conjugated)
TA890030BM

USD 420.00

4 Weeks

Rabbit polyclonal anti-PRKCD Antibody, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Immunogen Recombinant protein of human PRKCD
PKC delta (PRKCD) Rabbit Polyclonal Antibody
TA890030S

USD 159.00

2 Days

Rabbit polyclonal anti-PRKCD Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKCD
Casein Kinase 2 beta (CSNK2B) Rabbit Polyclonal Antibody
TA890031

USD 345.00

In Stock

Rabbit polyclonal anti-CSNK2B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CSNK2B
Casein Kinase 2 beta (CSNK2B) Rabbit Polyclonal Antibody
TA890031S

USD 159.00

2 Days

Rabbit polyclonal anti-CSNK2B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CSNK2B