Products

View as table Download

Rabbit Polyclonal Anti-EPN1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN1 Antibody: A synthesized peptide derived from human EPN1

Rabbit polyclonal anti-EPN1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human EPN1.

Rabbit Polyclonal Anti-EPN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN1 antibody: synthetic peptide directed towards the C terminal of human EPN1. Synthetic peptide located within the following region: AATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKASNPFLPG

Rabbit Polyclonal Anti-EPN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN1 antibody is: synthetic peptide directed towards the C-terminal region of Human EPN1. Synthetic peptide located within the following region: VSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSP