Epsin 1 (EPN1) Rabbit Polyclonal Antibody

CAT#: TA334477

Rabbit Polyclonal Anti-EPN1 Antibody

Product Images

Host: Rabbit; Target Name: EPN1; Sample Tissue: PANC1 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml; EPN1 is supported by BioGPS gene expression data to be expressed in PANC1

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EPN1 antibody is: synthetic peptide directed towards the C-terminal region of Human EPN1. Synthetic peptide located within the following region: VSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: epsin 1
• Database Link:
  NP_001123543
  Entrez Gene 29924 Human
  UniProt ID Q9Y6I3
• Background: The protein encoded by this gene binds clathrin and is involved in the endocytosis of clathrin-coated vesicles. Three transcript variants encoding different isoforms have been found for this gene.
• Synonyms: EH domain-binding mitotic phosphoprotein; epsin 1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Guinea pig: 86%

Reference Data

• Protein Pathways: Endocytosis