Products

View as table Download

Rabbit Polyclonal Anti-ILK Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ILK

Rabbit anti-ILK Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ILK

Rabbit polyclonal ILK (Ser246) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ILK around the phosphorylation site of serine 246 (I-F-SP-H-P).
Modifications Phospho-specific

Integrin Linked Kinase (ILK) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal ILK (Ab-246) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human ILK around the phosphorylation site of serine 246 (I-F-SP-H-P).

Rabbit Polyclonal anti-ILK Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ILK antibody is: synthetic peptide directed towards the C-terminal region of Human ILK. Synthetic peptide located within the following region: MKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQD