Rabbit polyclonal anti-AKR1C2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AKR1C2. |
Rabbit polyclonal anti-AKR1C2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AKR1C2. |
Rabbit Polyclonal Anti-AKR1C2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AKR1C2 antibody: synthetic peptide directed towards the N terminal of human AKR1C2. Synthetic peptide located within the following region: LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK |
Rabbit Polyclonal Anti-AKR1C2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AKR1C2 antibody: synthetic peptide directed towards the N terminal of human AKR1C2. Synthetic peptide located within the following region: DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV |
Rabbit anti ARK1C2 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |