Products

View as table Download

Rabbit Polyclonal Anti-ATP6V0E2 Antibody

Reactivities Human, Horse, Rabbit, Rat, Guinea pig, Dog, Bovine, Mouse, Zebrafish

Rabbit Polyclonal Anti-ATP6V0E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V0E2 antibody: synthetic peptide directed towards the middle region of human ATP6V0E2. Synthetic peptide located within the following region: TVAPLSLTTPSSGPSPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQP