Products

View as table Download

Rabbit Polyclonal Anti-ALLC Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALLC antibody: synthetic peptide directed towards the N terminal of human ALLC. Synthetic peptide located within the following region: VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE

ALLC Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated