ALLC Rabbit Polyclonal Antibody

CAT#: TA344861

Rabbit Polyclonal Anti-ALLC Antibody - N-terminal region

Product Images

WB Suggested Anti-ALLC Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ALLC antibody: synthetic peptide directed towards the N terminal of human ALLC. Synthetic peptide located within the following region: VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: allantoicase
• Database Link:
  NP_060906
  Entrez Gene 55821 Human
  UniProt ID Q8N6M5
• Background: Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution.
• Synonyms: ALC
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 85%; Rabbit: 85%; Horse: 83%; Bovine: 82%

Reference Data

• Protein Pathways: Metabolic pathways, Purine metabolism