Products

View as table Download

Rabbit polyclonal APRT Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This APRT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-40 amino acids from the N-terminal region of human APRT.

Rabbit anti-APRT Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human APRT

Rabbit Polyclonal Anti-APRT Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APRT antibody: synthetic peptide directed towards the N terminal of human APRT. Synthetic peptide located within the following region: ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK

Rabbit polyclonal APRT Antibody (C-term)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This APRT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-170 amino acids from the C-terminal region of human APRT.