Products

Jump to Filters
View as table Download
PBX1 Rabbit Polyclonal Antibody
TA329195

USD 375.00

5 Days

Rabbit Polyclonal anti-PBX1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PBX1 antibody: synthetic peptide directed towards the N terminal of human PBX1. Synthetic peptide located within the following region: MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQI
PBX1 Rabbit Polyclonal Antibody
TA379663

USD 220.00

3 Weeks

PBX1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 311-430 of human PBX1 (NP_002576.1).
Modifications Unmodified